The Boring PartsFederalLocal · USLocal · Canada
Burnaby, BC

Burnaby public meetings in 2024

123 substantive meetings from 2024, with official agendas or minutes and plain-English summaries.

Mon Dec 16, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Council reviews public correspondence on zoning, bylaws, and city services

This meeting consists of a review of correspondence and public notice submissions. Council and staff are addressing requests regarding building codes, anti-idling bylaws, and traffic noise, while receiving information on zoning and international delegations.

zoningtrafficbylawsbuilding-codepublic-correspondence
Mon Dec 16, 2024 · 5:00 PM

City Council Meeting

Council to review Brentwood Community Centre budget and multiple rezoning requests

Burnaby City Council is meeting to decide on an updated budget for the Brentwood Community Centre and a draft Urban Forest Strategy. The body will also consider several rezoning applications for residential and mixed-use developments and approve contracts for recycling trucks and insurance.

zoningbudgethousingenvironmentinfrastructuregrants
✓ Decided: Council approves $139M Brentwood Community Centre budget

Council approved the updated $139 million budget for the Brentwood Community Centre, along with an additional $7.3 million for a podium park, despite opposition from two councillors. Council also approved the Draft Urban Forest Strategy, advanced several rezoning applications, and awarded contracts for recycling trucks and construction insurance.

Council Chamber, City Hall
Wed Dec 4, 2024 · 2:00 PM

Executive Committee of Council

Council to endorse interim naming guidelines for civic assets

The Executive Committee will consider endorsing a set of interim guidelines and procedures for naming civic assets, pending a comprehensive naming policy. It will also review and approve the second intake of the Festivals Burnaby Grant program. The committee will vote on two $500 donation requests – one for Hope and Health’s 4th Annual Santa on the Pitch event and another for the Tsleil‑Waututh Nation Christmas Hamper and Toy Drive. Standard agenda items such as adoption of the agenda, minutes, and routine reports will also be addressed.

naminggrantscommunitycouncilpolicy
✓ Decided: Burnaby Executive Committee approves grants and civic naming guidelines

The Committee approved interim guidelines for naming civic assets and authorized several community grants. These include $54,600 for the second intake of the Festivals Burnaby Grant program and $500 contributions for both the Hope and Health for Life Society and the Tsleil-Waututh Nation Christmas Hamper and Toy Drive.

Council Chamber, City Hall
Mon Dec 2, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Burnaby council to consider removal of 166 trees for Cameron Centre redevelopment

At this meeting, Burnaby City Council will review staff notes on several public submissions, including a request to cut 166 trees for the Cameron Centre redevelopment, a proposal to amend the Business Licence Bylaw, and concerns about uncontrolled intersections at Southpoint Drive and Mission Avenue. Council members may ask questions, but no formal decisions are scheduled.

treesbylaw-amendmenttraffichousingparkingpublic-noticeplanning
Mon Dec 2, 2024 · 5:00 PM

City Council Meeting

Council to adopt zoning amendment for six‑storey rental and childcare at 7388 Southwynde

The City Council will consider a final adoption of Burnaby Zoning Bylaw Amendment No. 15 (REZ #22-02) that permits a six‑storey non‑market rental building with a childcare facility at 7388 Southwynde Avenue. The meeting also includes approvals for several contract awards, including group benefits providers (Manulife and Pacific Blue Cross), an Owner’s Representative for infrastructure delivery, and a contract for signage, road pavement markings and related electrical services. Additional items on the agenda are the Universal Water Metering Strategy presentation and updates on transit‑oriented area designations and unsightly premises bylaws.

zoninghousingchildcarecontractsinfrastructurebylawwatertransit
✓ Decided: Council approves universal water metering strategy over opposition

Council approved the universal water metering strategy, with Councillors Calendino and Dhaliwal opposed. Council also approved several contracts, including group benefits providers, and zoning bylaw amendments for short-term rentals and EV charging. A proposed delegation visit to sister cities was defeated.

Council Chamber, City Hall
Thu Nov 28, 2024 · 5:00 PM

Access Advisory Committee

Committee reviews Draft Accessibility Plan and pedestrian safety measures

The Access Advisory Committee will discuss the Draft Accessibility Plan for the City of Burnaby, presented by senior planners. It will also receive information on Accessible Pedestrian Signals, including a map of intersections with touchless signals. A delegation from Walkers' Caucus will present on intersection crossing safety for vulnerable pedestrians. No formal decisions are listed on the agenda.

accessibilitytransportationpedestrian-safetyplanningcommunity-engagement
Wed Nov 27, 2024 · 5:00 PM

Public Safety Committee

Delegation on children crossing safety at Twelfth Avenue Elementary

The Public Safety Committee will hear a presentation from the Twelfth Avenue Elementary Parent Advisory Council about children crossing 12 Ave and vehicles not stopping at stop signs. The committee will also receive status updates on the Burnaby Community Safety Plan, RCMP operations for August‑September 2024, and the Fire Department. Additional reports from the Community Safety Advisory Committee districts will be reviewed.

public-safetytrafficcommunitypolicefirereports
✓ Decided: Burnaby Public Safety Committee hears 12th Ave crosswalk safety concerns

The committee received a delegation from Twelfth Avenue Elementary PAC about cars not stopping at stop signs near the school. RCMP and the City's Transportation Department will address the concerns. The committee also received status updates on the Community Safety Plan, RCMP operations, Fire Department activities, and Community Safety Advisory Committee reports. No substantive decisions were made; all items were received for information.

Council Chamber, City Hall
Thu Nov 21, 2024 · 5:00 PM

Transportation Committee

Transportation Committee to consider approval of Burnaby EV charging strategy

The Transportation Committee will adopt its agenda and the minutes from the October 10 meeting, hear delegations on parking and intersection safety, and receive staff presentations on three projects. The committee will seek approval of the Burnaby Public Electric Vehicle Charging Strategy recommendations and implementation framework. Additional presentations will cover the Canada Way Bus Speed and Reliability Study and the Phase 2 update of the Edmonds Town Centre Cycling Network Project.

transportationelectric-vehiclesbus-speedcyclingparking-safetyintersection-safety
✓ Decided: Burnaby approves public EV charging strategy

The Transportation Committee unanimously approved the Burnaby Public Electric Vehicle Charging Strategy and directed staff to follow its implementation plan. The committee also received information reports on the Canada Way bus speed and reliability study and the Edmonds Town Centre cycling network project. A delegation on intersection safety at Metrotown was heard, with staff noting potential signal timing adjustments.

Council Chamber, City Hall
Tue Nov 19, 2024 · 2:00 PM

Financial Management Committee

Board of Trade delegation discusses partnership with the city

The Financial Management Committee will adopt its agenda and the minutes from the October 15 meeting. It will hear a delegation from the Burnaby Board of Trade presenting a partnership proposal, with speakers Angie Whitfield and Dana Martin. The committee will also receive updates on major capital projects in parks, recreation and culture, key IT initiatives for July‑December 2024, major civic building projects, and major engineering projects.

board-of-tradecapital-projectsit-initiativescivic-buildingsengineeringfinance
✓ Decided: Committee adopts agenda, minutes; receives four information reports

The Financial Management Committee held a routine meeting, adopting the agenda and previous minutes unanimously. No administrative reports or correspondence were received, and no substantive decisions were made. Four information reports on capital projects and IT initiatives were received for information only. The committee then moved into a closed session to discuss legal advice and preliminary municipal service negotiations.

Council Chamber, City Hall
Mon Nov 18, 2024 · 11:00 AM

International Relations and Friendship Cities Committee

Committee provides updates on sister and friendship city partnerships

The International Relations and Friendship Cities Committee will adopt its agenda and the minutes from its September 26 meeting, hear a verbal report on the status of sister and friendship city requests, and review correspondence from Shuangliu District, the City of Kushiro, and Hwaseong City.

international-relationssister-citiesfriendship-citiescorrespondencereports
✓ Decided: Committee declines new friendship city partnerships, confirms 2025 delegations

The committee unanimously agreed to reply to Shuangliu District Government that Burnaby is re-evaluating its existing Sister and Friendship Cities Partnerships and is not pursuing new ones. It also confirmed attendance at Kushiro's September 2025 event, declined Hwaseong's March 2025 invitation but offered a September visit, and directed staff to amend the 2025 Japan/Korea/Taiwan delegation report with updated dates and cost breakdowns for the December 2, 2024 Council meeting.

Council Chamber, City Hall
Mon Nov 18, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Council reviews BC Hydro Community Regreening Program update

Burnaby City Council will consider several correspondence items submitted for information. The agenda includes updates from Ministry of Children and Family Development, BC Hydro, Metro Vancouver, and local staff on topics such as adoption awareness, community regreening, affordable housing guidance, bus lane plans, and the Cameron Recreation Centre. No decisions or votes are scheduled; the council will simply receive and acknowledge the information.

environmenthousingtransportationcommunitychildren-services
Mon Nov 18, 2024 · 5:00 PM

City Council Meeting

Council to consider TransLink bus speed plan and multiple bylaws

The Burnaby City Council will adopt the agenda and minutes, hear a TransLink presentation on improving bus speed and reliability on Hastings Street, and consider several administrative reports. Items include funding for temporary Cameron Library staff, a new Unsightly Premises Bylaw, a five‑year service agreement with RecycleBC, and authorizations for multiple rezoning applications. The council will also review grant applications, fee‑bylaw amendments, and acting mayor appointments.

transitbusbylawrezoninglibraryrecyclinggrantscouncil
✓ Decided: Council endorses Hastings Street bus lane plan with public input

Council endorsed TransLink's Hastings Street bus speed and reliability improvements, dedicating curbside lanes to buses between Delta and Duthie Avenues from 7am to 7pm daily, with design to begin immediately and implementation by 2026. A motion to table the report for more public engagement was defeated, but an amendment directing staff to receive input from affected areas before proceeding was carried unanimously. Council also approved new library staffing, a new Unsightly Premises Bylaw, a five-year RecycleBC agreement, and advanced several rezoning applications.

Council Chamber, City Hall
Thu Nov 14, 2024 · 5:00 PM

Community Heritage Commission

Commission reviews heritage permits and agreements for local landmarks

The Community Heritage Commission is discussing a Heritage Revitalization Agreement for the Lonsdale Guardhouse Residence and a Heritage Alteration Permit for Overlynn Mansion. The body will also receive a status update on the Community Archives Strategy and Implementation Plan.

heritagezoningarchivesbylawspreservation
✓ Decided: Burnaby Community Heritage Commission approved heritage updates for two properties

The Burnaby Community Heritage Commission adopted the meeting agenda and previous minutes, and unanimously approved a Heritage Revitalization Agreement Bylaw for the Lonsdale Guardhouse Residence at 6985 Canada Way and a Heritage Alteration Permit for the Overlynn Mansion at 3755 McGill Street. The Commission also received information reports, correspondence regarding the Edmonds Baptist Church, and voted to send an appreciation letter for the completion of Roger Whitehouse's term.

Council Chamber, City Hall
Wed Nov 13, 2024 · 5:00 PM

Planning and Development Committee

Proposed amendments to allow short‑term rentals and clarify EV charging rules

The Planning and Development Committee will hear a delegation from Trinity Presbyterian Church regarding a proposed redevelopment at 7457 Edmonds. It will review proposed amendments to the Burnaby Zoning Bylaw that would permit short‑term rentals in buildings with secondary suites and clarify electric‑vehicle parking requirements. Staff will present preliminary findings from the Phase 3B Land‑Use Framework engagement. The meeting also includes routine agenda and minutes adoption.

zoninghousingtransportationdevelopmentplanning
✓ Decided: Committee approved zoning amendments for short-term rentals and EV charging

The Planning and Development Committee approved proposed amendments to the Burnaby Zoning Bylaw concerning short-term rentals and EV charging requirements, with an added condition regarding long-term rental suite occupancy. The committee also received a delegation regarding the redevelopment of 7457 Edmonds and a verbal report on the Phase 3B Draft Land Use Map Framework engagement.

Council Chamber, City Hall
Tue Nov 12, 2024 · 5:00 PM

Parks, Recreation and Culture Committee

BC Parkway Project update presented to committee

The Parks, Recreation and Culture Committee will receive a verbal report updating members on the BC Parkway Project. A second verbal report will provide information on the Fees and Charges Policy Framework. No decisions or votes are listed on the agenda.

parksrecreationcultureinfrastructurefees
✓ Decided: Committee hears BC Parkway update; no decisions made

The Parks, Recreation and Culture Committee received two verbal reports but made no substantive decisions. The BC Parkway Project update outlined proposed design features for six areas, with public feedback leading to the removal of a skatepark idea due to noise concerns. A Fees and Charges Policy Framework was also presented, with a future report planned to the Financial Management Committee. All procedural motions (agenda and minutes adoption) were carried unanimously.

Council Chamber, City Hall
Wed Nov 6, 2024 · 2:00 PM

Executive Committee of Council

Council will approve updates to the Community Grant Policy and award several local grants

The Executive Committee will consider and vote on proposed updates to the Community Grant Policy. It will also review and authorize a grant for the Down Syndrome Resource Foundation and award lunch/dinner grants to Burnaby seniors' groups. A verbal report on procedure bylaw updates will be presented.

grantscommunityseniorsbylawcouncil
✓ Decided: Burnaby approves Community Grant Policy updates and $10K Down Syndrome grant

The Executive Committee unanimously approved amendments to the Community Grant Policy, a $10,000 initiative grant for the Down Syndrome Resource Foundation, and a $12-per-attendee grant for 2024 seniors' lunch/dinner programs. The committee also discussed future Procedure Bylaw updates, including removing Section 7.2, to be brought back for review at a later meeting.

Council Chamber, City Hall
Wed Nov 6, 2024 · 5:00 PM

Environment Committee

Committee reviews small gas equipment delegation and climate action progress

The Burnaby Environment Committee will hear a presentation from Metro Vancouver staff about small gas‑powered equipment. It will also receive a Climate Action Framework Progress Report covering 2023‑2024. The meeting includes routine items such as adoption of the agenda and minutes, and concludes with adjournment.

environmentair-qualityclimate-actionreportsequipment
✓ Decided: Committee receives Climate Action Framework progress report

The Environment Committee received the Climate Action Framework Progress Report 2023-2024 for information, with no administrative reports or correspondence. It also unanimously approved sending a letter of appreciation to outgoing member Andrei Zawadzki and discussed a potential pilot program for composting and recycling in parks, with staff to report back.

Council Chamber, City Hall
Mon Nov 4, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Council reviews public correspondence and rezoning submissions

This meeting consists of a review of correspondence and public notice submissions. The items include requests for information, referrals to advisory bodies, and public feedback on a specific rezoning application.

zoningheritageparkingstadiumdevelopment
Mon Nov 4, 2024 · 5:00 PM

City Council Meeting

City Council to approve 2025 water and sewer utility rates

Burnaby City Council will consider approval for 2025 Waterworks and Sanitary Sewer utility rates, along with related bylaw amendments. The meeting also includes reports on the Burnaby Housing Needs Report, the Burnaby Food System Strategy, and the Burnaby Child Care Design Principles and Guidelines.

watersewerrateshousingfoodchild-carebylawcouncil
✓ Decided: Council approves 2025 utility rates, $2.1M computer contract, and food strategy

Council approved the 2025 waterworks and sanitary sewer utility rates, a $2.1M computer hardware contract, and adopted the Burnaby Food System Strategy. A proposed amendment to cap sewer rate increases at 9.9% annually was defeated. Council also endorsed draft community plans for Edmonds, Royal Oak, and Cascade Heights for public engagement.

Council Chamber, City Hall
Thu Oct 24, 2024 · 5:00 PM

Access Advisory Committee

Committee reviews Brentwood Town Centre accessibility pilot

The Access Advisory Committee will receive an information report regarding the Brentwood Town Centre Accessibility Improvement Pilot. The meeting also includes a presentation on the Mobility Access Participation (MAP) Project.

accessibilitytransportationbrentwood-town-centreurban-planning
✓ Decided: Committee directs staff to review adaptive fitness equipment in recreation centres

The Access Advisory Committee unanimously directed staff to review adaptive fitness equipment in Burnaby's recreation centres, including possible improvements and costs, and report back. The committee also received an information report on the Brentwood Town Centre Accessibility Improvement Pilot and heard presentations on the MAP Project. Several other inquiries were raised, including concerns about BC Parkway accessibility and the Accessibility BC Act, with staff undertaking to respond at future meetings.

Wed Oct 23, 2024 · 5:00 PM

Public Safety Committee

Burnaby to develop B‑SAFER earthquake resilience framework

The Public Safety Committee will adopt its agenda and the minutes from the June 26, 2024 meeting. It will review the new Earthquake Strategies and Actions Framework and hear a verbal report on bear‑spray use in the city. The committee will also receive status updates from the Community Safety Advisory Committee districts, the RCMP (April‑July 2024) and the Fire Department, plus a summary of 2024 extreme‑heat events.

earthquakepublic-safetyrcmpfirebear-sprayheat
✓ Decided: Burnaby committee backs earthquake resilience framework and bear spray bylaw study

The Public Safety Committee unanimously authorized staff to develop an earthquake resilience framework (B-SAFER) and to investigate a bylaw regulating bear spray use in Burnaby. It also received status reports from the RCMP, fire department, and community safety advisory committees, and accepted the resignation of a committee member.

Council Chamber, City Hall
Tue Oct 22, 2024 · 5:00 PM

Environment Committee

Committee reviews sturgeon partnership and cat‑control bylaw proposals

The Environment Committee will hear two invited presentations: the Fraser River Sturgeon Conservation Society will discuss a possible partnership, and the Stewardship Centre for BC will present a proposal for cat‑control bylaws. The committee will also consider correspondence on the Fossil Fuel Treaty, a biodiversity bylaw reform, and the Starry Night Initiative. No formal decisions are listed on the agenda.

environmentwildlifebylawsbiodiversitycat-controlsturgeonfossil-fuel
✓ Decided: Committee asks staff to study allowing habitat gardens in Burnaby

The Environment Committee unanimously approved a motion directing staff to explore the feasibility and advisability of allowing habitat gardens in Burnaby. The committee also heard presentations on sturgeon conservation and roaming cats, and noted that City Council had already endorsed the Fossil Fuel Treaty. No other substantive decisions were made.

Council Chamber, City Hall
Mon Oct 21, 2024 · 5:00 PM

City Council Meeting

Council to consider rezonings, transit shelters, and liquor policy changes

The Burnaby City Council will consider rezoning proposals for industrial and multi-family developments, approve a contract increase for transit shelters, and adopt bylaws related to liquor licensing and inter-municipal business fees.

zoningtransitliquorbusiness-licencedevelopmentcouncilbylaw
✓ Decided: Council approves liquor/cannabis licensing bylaw changes with $5,000 fee

Council approved amendments to the Burnaby Zoning Bylaw, Development Procedures Bylaw, and Consolidated Fees and Charges Bylaw to implement the liquor and cannabis licensing policy, including repealing the old liquor licence application fee bylaw and discharging related covenants. An amendment set the licence fee for cannabis and liquor stores at $5,000. The motion carried with Councillor Lee opposed.

Council Chamber, City Hall
Mon Oct 21, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Council reviews correspondence on fossil fuels, recreation, and cycling

This meeting consists of a review of correspondence and public notice submissions. Items are being referred to advisory bodies or provided to Council for information.

correspondenceenvironmentrecreationcyclinghousing
Thu Oct 17, 2024 · 5:00 PM

Planning and Development Committee

Committee reviews draft community plans for Edmonds, Royal Oak, and Cascade Heights

The Planning and Development Committee is discussing updates to the Burnaby Housing Needs Report to meet provincial requirements. The body is also seeking endorsement for draft community plans for three areas to begin a final phase of public engagement.

housingcommunity-planningzoningburnaby
✓ Decided: Council endorses draft community plans for Edmonds, Royal Oak, Cascade Heights

The committee unanimously endorsed the draft community plans for Edmonds, Royal Oak, and Cascade Heights, authorizing staff to conduct Phase 3 engagement and work with rezoning applicants based on the draft plans. The interim update to the Burnaby Housing Needs Report was received and its 2024 interim requirements will be published on the city's website.

Council Chamber, City Hall
Wed Oct 16, 2024 · 5:00 PM

Social Planning Committee

Committee reviews draft food system strategy and child care design guidelines

The Social Planning Committee is reviewing draft strategies for food systems and child care design principles to be presented for Council approval. The meeting also includes presentations on poverty reduction and food security.

food-securitychild-carepoverty-reductionsocial-planning
✓ Decided: Burnaby adopts child care design principles and food system strategy

The Social Planning Committee unanimously adopted the Burnaby Child Care Design Principles and Guidelines, applying them to all new City-related child care facilities. It also adopted the Burnaby Food System Strategy, including an amendment directing staff to explore partnerships for a pilot food forest on City land. The committee heard delegations on food security and poverty reduction but made no other decisions.

Council Chamber, City Hall
Tue Oct 15, 2024 · 2:00 PM

Financial Management Committee

Committee considers temporary financing bylaw for 2025 expenditures

The Financial Management Committee is meeting to discuss borrowing authority for 2025 spending and a joint funding application for renewable energy. The body will also review financial reports and status updates on housing and civic building projects.

budgetfinancingrenewable-energyhousinginfrastructure
Council Chamber, City Hall
Thu Oct 10, 2024 · 5:00 PM

Transportation Committee

Committee considers pedestrian safety measures and new sidewalk program

The Transportation Committee is reviewing a feasibility assessment for pedestrian safety improvements to approve short-term measures and detailed designs. The body will also receive presentations on a new sidewalks program and an Intelligent Transportation Systems Strategic Plan.

pedestrian-safetysidewalkstraffic-safetytransportation-planning
Council Chamber, City Hall
Mon Oct 7, 2024 · 5:00 PM

City Council Meeting

Council to consider a new height‑based development framework and related policy changes

The Burnaby City Council will adopt the agenda and minutes, then review several administrative reports including a proposed height‑based development framework and approvals for contracts such as the Burnaby Laneway Upgrades and re‑roofing of the Bonsor Recreational Complex. Committee reports will present proposed zoning bylaw amendments for child‑care and the new R1 district, a review of the Tenant Assistance Policy, and a study of short‑term rental options. The council will also conduct third‑reading votes on rezoning applications at 4472 and 4828 Hastings Street and adopt fee‑bylaw amendments for 2025. A scheduled public hearing for October 29 is slated for cancellation due to lack of items.

zoningdevelopmentcontractsbylawshousinginfrastructure
Council Chamber, City Hall
Mon Oct 7, 2024 · 10:00 AM

Tax Sale

Tax Sale meeting scheduled for October 7, 2024

The provided agenda contains only procedural boilerplate and software interface text. No specific items, decisions, or discussion topics are listed in the record.

tax-saleprocedural
✓ Decided: Burnaby tax sale sells Dundas Street property for $660,000

The City of Burnaby held its 2024 tax sale on October 7, 2024, with five bidders in attendance. One property at 3848 Dundas Street was auctioned and sold to Deen Gao for $660,000. The meeting was procedural and focused solely on this sale.

Council Chamber, City Hall
Mon Oct 7, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Council reviews staff notes on laneway houses, noise bylaws, and sidewalk requests

The council will receive staff responses to several public submissions, including electrical interpretations for laneway houses, a request to reduce noise pollution and enforce the noise bylaw, and a request for sidewalks on Alaska Ave, Rosser Ave, and Juneau St. These items are for information only and no council action is required. Additional submissions are listed for informational purposes, such as the Burnaby Draft OCP and a free transit pass proposal for youth.

zoningbylawhousinginfrastructurecommunity-planpublic-engagement
Council Chamber, City Hall
Wed Oct 2, 2024 · 5:00 PM

Executive Committee of Council

Council considers lease agreements for community facilities and grant applications

The Executive Committee of Council is meeting to review proposed lease agreements for two city facilities. The body will also consider recommended recipients for Fall 2024 community grants and a new framework for advisory body roles.

leasescommunity-grantsgovernancenon-profits
Council Chamber, City Hall
Thu Sep 26, 2024 · 2:00 PM

International Relations and Friendship Cities Committee

Committee to discuss draft Sister and Friendship Cities Policy

The International Relations and Friendship Cities Committee is meeting to establish a new Sister and Friendship Cities Policy. The body will also review correspondence regarding international partnerships.

international-relationspolicyfriendship-cities
Council Boardroom, City Hall
Wed Sep 25, 2024 · 5:00 PM

Planning and Development Committee

Committee will consider zoning bylaw changes for child care and R1 district

The Planning and Development Committee will review updates to the Tenant Assistance Policy, consider proposed amendments to the Zoning Bylaw to enable new child‑care spaces and support the new R1 district, and examine a council report on allowing short‑term rentals in primary dwellings with long‑term secondary suites. Information reports will provide updates on market and non‑market rental housing development and on the Burnaby 2050 Official Community Plan Phase 3A public‑engagement findings.

zoningchild-careshort-term-rentalhousingofficial-community-plan
Council Chamber, City Hall
Mon Sep 23, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

City to consider new sidewalks on 13th Avenue in future capital review

Council will review staff notes on several public submissions, including a request for new sidewalks on 13th Avenue, the removal of temporary tables and chairs at Metrotown Station, and outdoor art at Metrotown Station. Staff will provide information or follow‑up on low‑cost housing inquiries and the Burnaby Draft Official Community Plan. Items are being logged for future capital project review and advisory referral.

sidewalkstransportationparkshousingplanningcommunitypublic-noticeadvisory
Mon Sep 23, 2024 · 5:00 PM

City Council Meeting

Council to approve contract increase for Community Safety Building project

The Burnaby City Council will consider a range of items including administrative reports on child‑care funding, a mixed‑use rezoning at Canada Way, a temporary use permit for a food‑processing site, and several contract increases for city projects. Committee reports will present proposals for 2025 lease rates, a festivals grant, a civic plaque policy, naming guidelines for civic assets, and property tax exemptions. The meeting also includes consent agenda items on building permits and major engineering projects, and several bylaw readings related to zoning and highway closures.

zoningcontractscommunity-safetylibrarybridgetemporary-usehousing
Council Chamber, City Hall
Thu Sep 12, 2024 · 10:00 AM

Financial Management Committee

Committee to review property tax exemptions and housing initiative funding

The Financial Management Committee is seeking approval for permissive property tax exemptions for 2025 and 2026. The body will also discuss the use of provincial capacity funding for local government housing initiatives and receive updates on major engineering and civic building projects.

property-taxhousinginfrastructurebudgetcivic-buildings
✓ Decided: Committee refers Burnaby Winter Club tax exemption phase-out to staff

The Financial Management Committee referred a report on permissive tax exemptions for 2025-2026 back to staff to develop a process for phasing out the tax reduction for the Burnaby Winter Club. The committee also approved the proposed distribution of provincial Capacity Funding for local government housing initiatives. Two information reports on major engineering and civic building projects were received for information. The meeting included a delegation advocating for a property tax cap, but no decision was made on that request.

Council Chamber, City Hall
Tue Sep 10, 2024 · 5:00 PM

Parks, Recreation and Culture Committee

Committee receives updates on Central Park and Burnaby Mountain plans

The Parks, Recreation and Culture Committee is meeting to receive verbal staff reports on several park initiatives. These include updates on environmental programs, trail management, and master planning.

parksenvironmenttrailsplanning
✓ Decided: Committee hears updates on environmental programs and park plans

The Parks, Recreation and Culture Committee received informational presentations on environmental programs, the Burnaby Mountain Trail Management Plan, and the Central Park Master Plan Phase 1. No formal decisions were made; the committee adopted the agenda and previous minutes unanimously.

Council Chamber, City Hall
Mon Sep 9, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Council reviews public notice submissions, including rezoning of Sunset and Kincaid Streets

Burnaby City Council will review correspondence and public‑notice submissions received for the September 9, 2024 meeting. Items include a rezoning request (REZONING #20-15) for Sunset Street and Kincaid Street, several informational documents from neighboring municipalities, and updates on regional projects. No decisions are recorded; the council will consider the information presented.

zoningregional-planninginfrastructurepublic-noticecouncil
Bill Copeland Sports Centre
Mon Sep 9, 2024 · 5:00 PM

City Council Meeting

Council adopts fee, zoning, expropriation bylaws and housing agreements

The council will adopt several amendment bylaws affecting fees, fire services, sewer connections, parking meters, electric‑vehicle charging, and a Boundary Road maintenance agreement. It will consider zoning bylaw amendments for REZ #23‑01 (8304 11th Avenue), REZ #23‑22 (4567 Canada Way) and REZ #24‑06 (4657 Kingsway), as well as a housing agreement bylaw for 3856 and 3864 Carrigan Court. Administrative reports will seek approval for a housing agreement on a portion of 7000 Lougheed Highway, the expropriation of part of 5595 Roy Street for the Holdom Overpass project, and a contract increase for hired equipment services. Additional items include a short‑term rental amendment to the zoning bylaw and a mayoral reconsideration of Bylaw 14207, while two public hearings are cancelled.

zoningfeeshousingexpropriationcontractsbylawsdevelopment
✓ Decided: Council approves expropriation for Holdom Overpass, advances housing agreements

Council unanimously approved the expropriation of 5595 Roy Street for the Holdom Overpass project, authorized housing agreements for non-market units at 7000 Lougheed Highway, and approved a contract increase for hired equipment services. Council also reconsidered and passed third reading of Bylaw 14207 (rezoning) with a 6-3 vote, referred a short-term rental motion to committee, and cancelled upcoming public hearings due to lack of business.

Council Chamber, City Hall
Wed Sep 4, 2024 · 2:00 PM

Executive Committee of Council

Committee to review lease rates and grants for Community Resource Centres

The Executive Committee of Council is meeting to discuss administrative policies and funding. The body is seeking approval for naming guidelines, plaque policies, and grant recommendations.

grantsnon-profitscivic-policycommunity-resources
✓ Decided: Committee approves interim civic asset naming guidelines

The Executive Committee of Council approved interim guidelines for naming civic assets, with amendments to allow naming living individuals (excluding current elected officials/staff) and to include decommissioning and plaque installation provisions. It also approved a Civic Buildings plaque policy, a $1,500 Festivals Burnaby grant, and 2025 lease rates and grants for Community Resource Centres. All decisions were carried unanimously.

Council Chamber, City Hall
Mon Aug 26, 2024 · 11:00 AM

Council Correspondence and Public Notice Submissions

Council reviews staff notes, advisory referrals, and rezoning submissions

On August 26, 2024, Burnaby City Council will consider a package of correspondence and public‑notice submissions. Items include staff notes on waste‑stream recycling, a new sidewalks program for Madison and Rosser Avenues, and a proposal to promote quieter, greener equipment under the noise bylaws. The council will also refer biodiversity bylaw reform letters to the Environment Committee and review a rezoning submission for properties on Sunset Street and Kincaid Street.

councilcorrespondencepublic-noticerezoningsidewalkswaste-recyclingnoise-bylawsbiodiversity
Mon Aug 26, 2024 · 5:00 PM

City Council Meeting

Burnaby Council to consider new Indigenous relations framework and fee changes

City Council is reviewing a proposed Indigenous Relations and Reconciliation framework and strategy. The meeting includes decisions on several contract awards for infrastructure and road upgrades, as well as proposed fee changes for January 1, 2025.

indigenous-relationszoninginfrastructurefeeshousing
Council Chamber, City Hall
Tue Jul 23, 2024 · 2:30 PM

International Relations and Friendship Cities Committee

Committee to consider approving 2025 sister‑city delegation to Japan, Korea, Taiwan

The International Relations and Friendship Cities Committee will adopt its agenda and the minutes from the January 11, 2024 meeting. It will receive a report on learning outcomes from the recent sister‑city visit to Mesa, Arizona. The committee will consider approving a council delegation for a 2025 visit to sister cities Kushiro (Japan) and Hwaseong (South Korea) and friendship city Taichung (Taiwan).

international-relationssister-citiestravelreportscorrespondence
Council Chamber, City Hall
Mon Jul 22, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Council reviews staff responses to public correspondence and notices

This meeting consists of correspondence and public notice submissions. Staff provided responses regarding local ecology, parking bylaws, and infrastructure maintenance, while other items were referred to advisory bodies or provided for information.

zoningparkinginfrastructureenvironmentpublic-notices
Mon Jul 22, 2024 · 5:00 PM

City Council Meeting

Council to approve contract for Cameron Community Centre Phase II construction

The Burnaby City Council will consider a contract award to complete construction of the Cameron Community Centre and Library Phase II. It will also review a bylaw to introduce Development Cost Charge and Amenity Cost Charge waivers and reductions, and forward several rezoning proposals to future readings. Additional items include a community school grant payment and updates on various committees and policies.

zoninghousingdevelopmentcontractscommunity-grantsinfrastructurefinance
✓ Decided: Council approves $191.1M contract for Cameron Community Centre and Library Phase II

Council unanimously approved a $191.1 million contract to Graham Construction & Engineering LP for the Cameron Community Centre and Library Phase II project, including a $10.5 million contingency. Council also directed staff to include the Burnaby Community Assembly's 24 recommendations as input into the Burnaby 2050 engagement, and approved several rezoning referrals and contract increases. A motion to refer the Transportation Demand Management guidelines for further review was defeated, and the guidelines were approved with two councillors opposed.

Council Chamber, City Hall
Mon Jul 22, 2024 · 1:00 PM

Special Council Meeting

City to review Urban Forest Strategy Phase 2 visioning

City Council will receive an information report on the Urban Forest Strategy Phase 2 visioning process and results. Staff will present findings from public engagement and a visioning presentation.

urban-forestenvironmentplanningcouncil
✓ Decided: Council receives urban forest strategy engagement report

Council received the Urban Forest Strategy Phase 2: Visioning report for information, with no decisions made. Staff will compile public input and Council feedback into recommendations for a draft strategy in Fall 2024.

Council Chamber, City Hall
Tue Jul 16, 2024 · 2:00 PM

Financial Management Committee

Council to approve the 2024‑2034 Community Works Fund Agreement

The Financial Management Committee will consider and seek approval for the new 2024‑2034 Community Works Fund Agreement. It will also review a proposed increase to on‑street public pay parking fees in the Metrotown Town Centre. Additional items include a financial report for period 05, updates on major civic building and engineering projects, and a report on key IT initiatives. The meeting is closed to the public under the Community Charter.

community-worksparking-feesfinancecivic-buildingsengineeringit-initiatives
Council Chamber, City Hall
Wed Jul 10, 2024 · 5:00 PM

Planning and Development Committee

Burnaby reviews land use engagement plan and liquor policy directives

The committee will consider a proposed engagement plan for the Burnaby 2050 Draft Land Use Framework. Staff will also seek approval for recommended liquor and cannabis policy directives. Additionally, the meeting includes discussions on transportation demand management in transit-oriented areas.

zoninghousingliquorcannabistransportationplanning
Council Chamber, City Hall
Mon Jul 8, 2024 · 5:00 PM

City Council Meeting

Burnaby Council reviews major residential, hotel, and infrastructure proposals

The meeting includes discussions on development procedures, anti-racism frameworks, and infrastructure projects. Council will also review contract awards for road rehabilitation, food supplies, and sidewalk expansions. Additionally, several rezoning applications for residential and hotel developments are up for final readings.

zoninghousinginfrastructuredevelopmentbylawsfifa
Council Chamber, City Hall
Thu Jul 4, 2024 · 5:00 PM

Board of Variance

Zoning appeal for new single-family home at 4391 Mahon Avenue

The Board of Variance will review an application for property variances at 4391 Mahon Avenue. The appeal seeks to permit a new single-family dwelling with a secondary suite, a detached garage, and an uncovered swimming pool. Requested changes include adjustments to front yard depth, building setbacks, and fence height.

zoninghousingresidentialappealburnaby
Council Chamber, City Hall
Wed Jun 26, 2024 · 5:00 PM

Public Safety Committee

Public Safety Committee to discuss parking issues and crime reports

The committee will hear a delegation regarding parking issues on Canada Way and Sperling Avenue. The agenda also includes updates on catalytic converter theft, RCMP operations, and fire department activities.

parkingcrimercmpfire departmentpublic safety
Council Chamber, City Hall
Tue Jun 25, 2024 · 9:00 AM

Planning and Development Committee

Committee reviews bylaw amendments and stormwater rules for multi-unit housing

The committee will review proposed amendments to the Burnaby Development Procedures Bylaw. Staff will also present on stormwater management requirements for R1 Small Scale Multi-Unit Housing zones. Additionally, the committee will receive findings from an employment lands needs assessment.

zoninghousingbylawsstormwatereconomic-development
Council Chamber, City Hall
Mon Jun 24, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Staff notes intention to pave and maintain Avalon Trail

This meeting reviews council correspondence and public notices. Engineering staff noted plans to address uneven surfaces on the Avalon Trail through paving work to improve safety and width. The agenda also includes various Metro Vancouver reports and community correspondence.

trailsinfrastructureenvironmentpublic noticecorrespondence
Mon Jun 24, 2024 · 5:00 PM

City Council Meeting

Burnaby Council considers major residential rezoning and new EV charging rules

The meeting includes a final report from the Mayor's Task Force on Unsheltered Community Members. Council will also consider several rezoning applications for residential and self-storage facilities. Additionally, the agenda features updates on transit-oriented areas and new electric vehicle charging mandates.

zoninghousingtransitinfrastructureenvironment
Council Chamber, City Hall
Wed Jun 19, 2024 · 5:00 PM

Environment Committee

Committee to consider 2024 World Rivers Day program approval

The committee will review a proposed program for 2024 World Rivers Day for approval. Members will also receive updates on the City Energy Strategy and the Construction and Demolition Waste Diversion Bylaw implementation. Two delegations are scheduled to present to the committee.

environmentenergywastebylawsclimate
Council Chamber, City Hall
Thu Jun 13, 2024 · 5:00 PM

Community Heritage Commission

Proposal to integrate 6570 Deer Lake Avenue into Deer Lake Park

The Commission will review a proposal to incorporate the Louis and Annie Hill Residence at 6570 Deer Lake Avenue into Deer Lake Park for visitor use. Staff will also provide updates on the Heritage Burnaby website and the Community Archives Strategy.

heritagearchivesparksburnaby
Council Chamber, City Hall
Tue Jun 11, 2024 · 5:00 PM

Parks, Recreation and Culture Committee

Committee reviews park protection, prioritization, and FIFA event opportunities

The committee will review several information reports regarding city parks and community services. Discussions include park prioritization, land protection strategies, and the BC Parkway Framework Plan. Members will also provide feedback on outdoor aquatics and potential FIFA partnerships.

parksrecreationplanningfifacommunity-events
Council Chamber, City Hall
Mon Jun 10, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Burnaby Council reviews correspondence on transit, housing, and energy

This meeting consists of reviewing correspondence provided to Council for information. The items include communications regarding the Sue Big Oil campaign, District Energy Utilities, and a proposed BRT line.

housingtransitenergypublic-noticeburnaby
Mon Jun 10, 2024 · 5:00 PM

City Council Meeting

Burnaby Council moves to adopt new small-scale multi-unit housing regulations

The City Council is reviewing several bylaw amendments, including transit-oriented area designations and building energy standards. The meeting also includes the final adoption of rezoning for small-scale multi-unit housing in residential neighborhoods.

housingzoningtransitenvironmentbylawsinfrastructure
Council Chamber, City Hall
Wed Jun 5, 2024 · 5:00 PM

Executive Committee of Council

Council to consider summer grant recommendations for Festivals Burnaby

The Executive Committee will review grant recommendations for the Summer Intake 2024 Festivals Burnaby Grant Program. The meeting also includes a presentation from the Burnaby Arts Council and correspondence regarding the Whey-ah-Wichen Canoe Festival.

grantsartsfestivalscommunity-events
Council Chamber, City Hall
Thu May 30, 2024 · 5:00 PM

Access Advisory Committee

Access committee to hear accessibility strategy engagement summary

The Access Advisory Committee is meeting to hear an invited presentation on the Accessibility Strategy Engagement Summary from Urban Matters, and to receive updates on accessibility features in major civic building projects, the Burnaby 2050 Official Community Plan, and the BC Parkway Enhancement Project. The agenda includes adoption of previous minutes and no administrative reports or correspondence.

accessibilitycivic-buildingscommunity-planparkwayengagement
Wed May 29, 2024 · 5:00 PM

Transportation Committee

Committee to review Vancouver-SFU cycling connection improvements

The Transportation Committee will hear a delegation about electric items on streets and sidewalks, and review an update on the Vancouver-SFU Cycling Connection Project, seeking endorsement to proceed with detailed design. Correspondence includes recommendations for the Parkway Alive Project and suggestions on car traffic volume on a bike route. Minutes from the March 27, 2024 meeting will be adopted.

cyclingtransportationpublic-hearingcorrespondencedelegation
Council Chamber, City Hall
Mon May 27, 2024 · 1:00 PM

Special Council Meeting

Council to discuss DCC/ACC waivers and reductions options

This is a special council meeting with one administrative report: options for waivers and reductions under the Development Funding Program, covering Development Cost Charges and Amenity Cost Charges. Council will receive information and discuss these options; no decisions are listed on the agenda.

development-fundingdevelopment-cost-chargesamenity-cost-chargeswaiverscouncil-meeting
Council Chamber, City Hall
Mon May 27, 2024 · 5:00 PM

City Council Meeting

Council to vote on transit-oriented area designations and multiple contract awards

Burnaby City Council is meeting to consider a bylaw designating Transit-Oriented Areas as required by provincial law, and to approve several contract awards and increases for roadworks, fire engines, sidewalk repaving, and noise fence replacement. They will also review committee recommendations on grants, fee amendments, childcare policy, and park programs, and give first/second reading to several zoning bylaws, including small-scale multi-unit housing changes.

zoninghousingcontractstransitparksgrants
Council Chamber, City Hall
Mon May 27, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Council reviews public correspondence on trees, fireworks, traffic, and rezoning

This is a routine council correspondence and public notice submissions meeting. Staff provide notes on public letters, refer some to advisory bodies, and list others for information. No decisions are made; items are for review and response.

correspondencetreesfireworkstrafficrezoningpublic-safety
Wed May 22, 2024 · 5:00 PM

Social Planning Committee

Burnaby committee to review proposed Anti-Racism Framework and 2024-25 work plan

The Social Planning Committee is meeting to consider the proposed Burnaby Anti-Racism Framework and seek approval to develop an implementation plan. Members will also review the committee's 2024-2025 work plan, discuss initiating a Community and Social Infrastructure Needs Assessment, and hear a delegation on World Elder Abuse Awareness Day.

anti-racismsocial-planningcommunity-infrastructureelder-abusework-plancorrespondence
Council Chamber, City Hall
Tue May 21, 2024 · 2:00 PM

Financial Management Committee

Burnaby committee to consider mid-year fee changes and E-Comm shared services deal

The Financial Management Committee will consider mid-year 2024 amendments to the Consolidated Fees and Charges Bylaw, with changes effective July 1 and September 1, 2024. It will also seek approval to negotiate a shared services agreement for the E-Comm Burnaby Information Channel. Several information reports will be presented, including updates on federal and provincial funding programs and major civic building projects.

feesbudgetgrantspublic-safetyclimatecapital-projects
Council Chamber, City Hall
Wed May 15, 2024 · 5:00 PM

Planning and Development Committee

Committee to weigh child-care policy and subdivision bylaw changes

The Planning and Development Committee is meeting to discuss two administrative reports: proposed policy directions to support new child care spaces, and interim amendments to the Subdivision Control Bylaw regarding development servicing for building permits. No delegations, information reports, or correspondence are listed. The agenda is otherwise procedural, including adoption of the agenda and minutes from the April 8, 2024 meeting.

child-carezoningbylawdevelopment
Council Chamber, City Hall
Mon May 13, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Council reviews public correspondence on GRO project, bylaw, and recreation closures

This is a Council correspondence and public notice submissions meeting where staff present letters from residents and organizations for Council's information or referral. Items include a note on the GRO project, a bylaw amendment request, and correspondence about the Cameron Recreation Complex demolition and closure, Deer Lake Bridge design, Surrey police transition, and provincial bills. No public notice submissions were received.

correspondencepublic-noticebylawparksrecreationpolicinghousing
Mon May 13, 2024 · 5:00 PM

City Council Meeting

Council to consider final adoption of Grosvenor Brentwood high-rise project

Burnaby City Council is meeting to consider a range of administrative reports, committee recommendations, and bylaw readings. Key items include final adoption of the Grosvenor Brentwood development, a contract award for Barnet Road rehabilitation, and a contract increase for green waste processing. Council will also discuss a proposed 50-unit affordable housing project with a church and a response to the Sue Big Oil campaign.

zoninghousingroadscontractsemergency-preparednessparksalcohol
Council Chamber, City Hall
Wed May 8, 2024 · 2:00 PM

Executive Committee of Council

Committee to decide Taylor Park playground grant, festival grants, homeless society grant

The Executive Committee of Council is meeting to consider several grant approvals: a playground development grant for Taylor Park Elementary School, spring 2024 Festivals Burnaby grants, and a reconsideration of community grant application #24.01.I from The Society to End Homelessness in Burnaby. The committee will also receive correspondence about a regional heritage fair and Labour Day carousel ride co-sponsorship. The meeting includes adoption of the agenda and minutes from April 3, 2024, and will move to a closed session for matters involving personal information about a potential municipal award or gift.

grantsplaygroundfestivalshomelessnesscommunity-grantsheritagelabour-day
Council Chamber, City Hall
Mon Apr 29, 2024 · 5:00 PM

City Council Meeting

Council to award Burnaby Lake Recreation Complex Phase II contract

Burnaby City Council is meeting to decide on several contract awards, including the Burnaby Lake Recreation Complex Phase II design-build contract, and to set 2024 property and BIA tax rates. Council will also consider multiple rezoning applications for non-market rental housing, a holiday lighting cost-saving option, and several bylaws. The agenda includes presentations on complex care housing and local hero awards, plus a petition regarding Brentwood Park and Bill 47.

contract-awardtax-ratesrezoninghousingparkspetition
Council Chamber, City Hall
Mon Apr 29, 2024 · 1:00 PM

Special Council Meeting

Council to vote on incorporating Burnaby Housing Authority as municipal corporation

This special council meeting will consider two administrative reports on the proposed Burnaby Housing Authority (BHA). Council will vote on formally incorporating the BHA as a municipal corporation and review key financial considerations, including impacts of recent provincial housing legislation, construction costs, funding sources, and borrowing procedures. The meeting then moves into a closed session to discuss personal information about a candidate for a municipal position.

housingcouncil-meetingmunicipal-corporationfinancelegislation
Council Chamber, City Hall
Mon Apr 29, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Council reviews correspondence on Brentwood TODA, bike races, housing policy

This is a routine correspondence and public notice submission meeting where Council reviews letters received. Staff notes address a Brentwood Park transit-oriented development area letter, and support for resuming grassroots bike racing at Glenlyon. No items were referred to advisory bodies or received as public notice submissions.

correspondencehousingtransit-oriented-developmentbike-racingpublic-notice
Wed Apr 24, 2024 · 5:00 PM

Public Safety Committee

Burnaby committee to consider emergency preparedness grant application

The Public Safety Committee is meeting to consider endorsing a grant application for the Community Emergency Preparedness Fund related to public notification and evacuation route planning. The committee will also receive status reports from the RCMP, Fire Department, and Community Safety Advisory Committees, plus verbal updates on the Guns and Gangs Initiative and the RCMP Bike Unit.

public-safetyemergency-preparednessrcmpfire-departmentgrantscommunity-safety
Council Committee Room, City Hall
Mon Apr 22, 2024 · 5:00 PM

Environment Committee

Committee to review 2024 Environment Week program and recycling report

The Environment Committee is meeting to review and seek approval of the 2024 Environment Week program, receive the 2023 Solid Waste and Recycling annual report, and hear a verbal update on climate action work. The agenda also includes adoption of prior minutes and correspondence about loud vehicle prevention. No delegations are scheduled.

environmentrecyclingsolid-wasteclimate-actionenvironment-week
Council Chamber, City Hall
Tue Apr 16, 2024 · 5:00 PM

Parks, Recreation and Culture Committee

Committee to hear Central Park Master Plan Phase 1 update

The Parks, Recreation and Culture Committee is meeting to hear staff presentations and seek feedback on several projects, including the Central Park Master Plan Phase 1, Burnaby Mountain Conservation Area Trail Management Plan, the new Park Pulse program, and the Urban Forest Management Strategy. The committee will also hear a delegation about women's field hockey, review correspondence on topics like the Confederation Park weight room and bowling centre, and discuss a notice of motion on a seniors weightroom.

parksrecreationculturemaster-plantrailsurban-forestcommunity-centre
Council Chamber, City Hall
Mon Apr 15, 2024 · 5:00 PM

City Council Meeting

Burnaby Council discusses zoning amendments, utility projects, and local service taxes

The City Council is reviewing several land-use updates, including small-scale multi-unit housing zoning changes and community plan directions. The agenda also includes discussions on a district energy utility project, park alcohol consumption policies, and various rezoning applications.

zoninghousingutilitiesparkstaxationdevelopment
Council Chamber, City Hall
Mon Apr 15, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Council reviews public correspondence on rezoning, Brentwood, transit, and Metro Vancouver bylaws

This is a Council correspondence and public notice submissions meeting where staff present letters from residents and agencies for information or response. No decisions are made; items include a note on the Byrne Road property, public submissions on the Amazing Brentwood master plan changes, and various Metro Vancouver and provincial updates.

correspondencepublic-noticerezoningbrentwoodmetrovancouvertransitdevelopment
Mon Apr 8, 2024 · 10:00 AM

Financial Management Committee

Committee to approve 2024 insurance contract renewals

The Financial Management Committee is meeting to consider approving the 2024 property and liability insurance program contract renewals. The agenda also includes information reports on the Gaming Reserve and Gaming Interest Reserve as of December 31, 2023, an update on major capital IT projects, and a status update on major civic building projects. No delegations or correspondence are scheduled.

insurancegaming-reserveit-projectscivic-buildingsfinance
Council Chamber, City Hall
Mon Apr 8, 2024 · 2:00 PM

Planning and Development Committee

Burnaby proposes zoning changes to allow small-scale multi-unit housing citywide

The Planning and Development Committee is considering amendments to the Burnaby Zoning Bylaw to implement provincial requirements for small-scale multi-unit housing in single- and two-family neighbourhoods, including rezoning all current R District properties to a new R1 SSMUH District. The committee will also discuss public consultation for several community plan updates and an OCP amendment for 6005 Pandora Street, plus hear delegations on affordable housing and BC Housing's BC Builds program.

zoninghousingcommunity-planningpublic-consultationtax-exemptionaffordable-housing
Council Chamber, City Hall
Thu Apr 4, 2024 · 12:00 PM

Mayor's Task Force on Unsheltered Community Members

Task force reviews final draft recommendations on shelter and housing

The Mayor's Task Force on Unsheltered Community Members is meeting to review and discuss final draft recommendations across four priority areas: creating shelter, developing housing types, coordinating outreach, and providing support services. The meeting includes a presentation on the draft recommendations and adoption of prior minutes. This is a working session focused on finalizing the task force's recommendations.

homelessnessshelterhousingoutreachsupport-servicestask-force
Shadbolt Centre for the Arts
Thu Apr 4, 2024 · 5:00 PM

Simon Fraser Liaison Committee

SFU Liaison Committee to hear updates on campus buildings, hydrogen hub, firehall

The Simon Fraser Liaison Committee is meeting to receive presentations and updates from SFU and City of Burnaby staff. Topics include a Civic Innovation Lab presentation, remarks from the mayor and SFU president, and updates on SFU buildings, the Hydrogen Hub, Firehall 8, UniverCity, and SFU's People Plan and Equity initiatives. No decisions are listed on the agenda.

sfuliaison-committeecivic-innovationhydrogen-hubfirehallunivercityequity
Burnaby Mountain Clubhouse
Wed Apr 3, 2024 · 2:00 PM

Executive Committee of Council

Committee to review sport hosting grant program and spring community grants

The Executive Committee of Council is meeting to consider two administrative reports: proposed revisions to the Sport Hosting Grant Program and recommended recipients for the Spring 2024 Community Grant intake. No delegations, information reports, or correspondence are scheduled. The meeting also includes a closed session to discuss personal information about an individual considered for a municipal award or honour.

grantssportscommunitycouncil-meeting
Council Chamber, City Hall
Tue Apr 2, 2024 · 2:00 PM

Audit Committee

Audit Committee meets to adopt minutes, then closes for annual report talks

The Audit Committee is meeting to adopt its agenda and the draft minutes from its April 4, 2023 open meeting. No delegations, administrative reports, information reports, or correspondence are listed. The committee will then move into a closed session, excluding the public under Sections 90 and 92 of the Community Charter, to discuss municipal objectives, measures, and progress reports for preparing the annual municipal report.

auditminutesclosed-sessionannual-report
Council Chamber, City Hall
Wed Mar 27, 2024 · 5:00 PM

Transportation Committee

Transportation Committee discusses school travel and cycling connectivity

The committee will receive an update on the Active School Travel Planning Strategy. The agenda also includes several pieces of correspondence regarding pedestrian accessibility, cycling, and commuting.

transportationcyclingpedestrian-safetyschool-travel
Council Chamber, City Hall
Tue Mar 26, 2024 · 5:00 PM

Public Hearing

Proposed heritage designation for the Eagle Ford Neon Sign

Burnaby City Council is holding a public hearing regarding the Heritage Designation Bylaw No. 1, 2024. The proposal seeks to add the Eagle Ford Neon Sign to the Burnaby Community Heritage Register and allow zoning variances for its installation on a City-owned sidewalk near Hastings Street.

heritagezoningpublic-hearing
VIA ZOOM OR IN-PERSON
Mon Mar 25, 2024 · 5:00 PM

City Council Meeting

Council to vote on new development cost charges and amenity cost charges bylaws

Burnaby City Council is meeting to consider a range of items, most notably approving new Development Cost Charges (DCC) and Amenity Cost Charges (ACC) bylaws, which impose fees on developers to fund infrastructure and amenities. Council will also decide on several rezonings, a temporary use permit for a grocery store, a parking reservation program at Barnet Marine Park, and a redevelopment of the Burnaby Mountain Bike Skills Course. The agenda includes delegations, committee reports, and the final adoption of a bylaw for two high-rise buildings on Willingdon Avenue.

zoningdevelopmentbylawsparksparkinghousingbudget
Council Chamber, City Hall
Mon Mar 25, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Council to review correspondence on rezoning, DCCs, and community issues

This is a procedural meeting to review correspondence and public notice submissions. No submissions were received in Section One, and three items were referred to advisory committees. The bulk of the agenda is correspondence for information, covering topics like development cost charges, short-term rentals, and a rezoning application. One public notice submission was received for rezoning at 6505 Sussex Avenue.

Wed Mar 20, 2024 · 5:00 PM

Social Planning Committee

Child care update and 2024 workplan before committee

The Social Planning Committee will review a report on the Child Care Resources Group's 2023 activities and proposed 2024 workplan. Members will also hear verbal updates on starting a community and social infrastructure needs assessment and a poverty reduction strategy process.

Council Chamber, City Hall
Thu Mar 14, 2024 · 2:00 PM

Parcel Tax Roll Review Panel

Panel to confirm 2024 sewer and local area service parcel tax rolls

The Parcel Tax Roll Review Panel is meeting to confirm and authenticate the 2024 Sewer Parcel Tax Roll and the 2024 Local Area Service Tax Roll. This is a routine procedural step required before the tax rolls take effect.

taxesparcel-taxsewerlocal-area-serviceprocedural
Council Chamber, City Hall
Wed Mar 13, 2024 · 5:00 PM

Planning and Development Committee

Committee to vote on liquor and cannabis policy directives

The Planning and Development Committee is meeting to consider approving recommended liquor and cannabis policy directives, and to receive updates on the Burnaby 2050 Official Community Plan project, including a draft vision statement and the initiation of a community and social infrastructure needs assessment. The meeting also includes adoption of the agenda and previous minutes, and a closed session for land and municipal service negotiations.

liquorcannabispolicyofficial-community-planburnaby-2050community-infrastructureplanning
Council Chamber, City Hall
Tue Mar 12, 2024 · 1:00 PM

Special Council Meeting

Council to set new development and amenity cost charge rates

Burnaby City Council is holding a special meeting to consider approving final Development Cost Charges (DCC) and Amenity Cost Charges (ACC) rates, which will form the basis of new bylaws. The agenda includes a presentation from Metro Vancouver about projects in Burnaby. The main decision is on the new rates, with supporting documents detailing program projects and final rates.

development-cost-chargesamenity-cost-chargesbylawsmetropolitan-vancouvercouncil-meeting
Council Chamber, City Hall
Mon Mar 11, 2024 · 5:00 PM

City Council Meeting

Council to consider $3.05M grant for non-market housing at 3838 Hastings St

Burnaby City Council is meeting to decide on several items, including a $3,054,700 grant for non-market housing, a new pedestrian bridge at Deer Lake, and a full-time nasal naloxone program. They will also consider bylaw amendments for water metering and parking, plus various committee reports and delegations.

housinggrantsparksbylawspublic-safetyzoning
Council Chamber, City Hall
Mon Mar 11, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Council reviews correspondence on rezoning, noise, and safety

This is a Council correspondence and public notice submissions meeting where staff notes and referrals are presented. Items include rezoning inquiries, noise complaints, and safety concerns, with no formal decisions made. No public notice submissions were received.

zoningtransit-oriented-developmentnoisepublic-safetycorrespondence
Wed Mar 6, 2024 · 2:00 PM

Executive Committee of Council

Burnaby committee to consider new sport hosting grant program

The Executive Committee of Council is meeting to consider three administrative reports: a proposed Sport Hosting Grant Program, a new contribution agreement with the Burnaby Neighbourhood House Society, and updates to advisory bodies' terms of reference. No delegations, information reports, or correspondence are listed. The meeting also includes a closed session for items such as personal information, labour relations, and legal advice.

grantscommunity-servicesgovernancecouncil-meeting
Council Chamber, City Hall
Wed Feb 28, 2024 · 5:00 PM

Public Safety Committee

Burnaby Public Safety Committee to weigh naloxone expansion, memorials policy

The Public Safety Committee is meeting to hear presentations and consider several public safety items. They will discuss a proposed policy on community-initiated memorials, an update on the nasal naloxone pilot program with a request to make it permanent, and direction to replace the Fire Services Bylaw. The committee will also receive status reports from the RCMP, Fire Department, and Community Safety Advisory Committee.

public-safetynaloxonememorialsfire-servicesrcmpcommunity-safety
Council Chamber, City Hall
Tue Feb 27, 2024 · 5:00 PM

Public Hearing

Public hearing on parking and loading bylaw amendments

Burnaby City Council is holding a public hearing to receive input on proposed amendments to the parking and loading sections of the Burnaby Zoning Bylaw 1965. The changes respond to the Transit-Oriented Development Parking and Transportation Demand Management Policy and recent changes to the Local Government Act. The hearing will be held in person and via Zoom on February 27, 2024.

zoningparkingbylawpublic-hearingtransportation
Council Chamber, City Hall
Mon Feb 26, 2024 · 2:00 PM

Special Council Meeting

Council to review proposed development cost and amenity cost charges

This is a special council meeting (meeting 2 of 3) to receive preliminary information on proposed Development Cost Charges (DCC) and Amenity Cost Charges (ACC). Council will consider approving draft rates and a communications plan. No final decisions are expected at this stage.

developmentfeesplanninghousingbudget
Council Chamber, City Hall
Mon Feb 26, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Council reviews correspondence on homeless camp, RCMP HQ, and development

This is a Council correspondence and public notice submissions meeting where staff provide notes on resident concerns, refer some items to advisory bodies, and share information items. Key topics include a homeless camp on Grandview Highway, the new RCMP headquarters, and potential rezoning near the Lougheed Town Centre. No public notice submissions were received.

homelessnesspolicezoningdevelopmentcorrespondencepublic-notice
Mon Feb 26, 2024 · 5:00 PM

City Council Meeting

Council to weigh hotel rezoning, theatre contract, and Hastings BIA renewal

Burnaby City Council is meeting to decide on several administrative items, including contract increases for the James Cowan Theatre redevelopment and the Christine Sinclair Community Centre renovation, a rezoning for a hotel at 6505 Sussex Avenue, and renewal of the Hastings Street Business Improvement Area. Council will also consider heritage designation for the Eagle Ford neon sign, a petition for AEDs at sports fields, and various reports on housing, investments, and project updates.

zoningcontractsheritagebusiness-improvement-areahousingpublic-safety
Council Chamber, City Hall
Thu Feb 22, 2024 · 11:00 AM

Mayor's Task Force on Unsheltered Community Members

Task force reviews draft recommendations on shelter and housing

The Mayor's Task Force on Unsheltered Community Members is meeting to review a draft of its recommendations, organized into four priority focus areas: creating shelter, developing a range of housing types, coordinating interagency outreach, and providing support services. The meeting includes adoption of the agenda and minutes from the December 12, 2023 meeting, followed by a presentation and round table discussions on the recommendations.

unshelteredhousingshelteroutreachsupport-servicestask-force
Shadbolt Centre for the Arts
Wed Feb 21, 2024 · 5:00 PM

Environment Committee

Burnaby Environment Committee to review 2024 Environment Week, awards, and conservation plans

The Environment Committee is meeting to discuss and seek approval for the 2024 Environment Week program, receive updates on a World Rivers Day sign and conservation of city-owned lands in Cariboo Heights, and hear a delegation on the Sue Big Oil campaign. The agenda also includes routine items like adopting minutes and receiving information reports on environmental awards and the Employee Transit Incentive Program.

environmentenvironment-weekconservationparksclimatetransitawards
Council Chamber, City Hall
Tue Feb 20, 2024 · 2:00 PM

Financial Management Committee

Burnaby committee to review 2023 investments, MRDT renewal, project updates

The Financial Management Committee is meeting to receive information reports on the city's 2023 investment program and 2024 forecast, the approved Municipal and Regional District Tax (MRDT) renewal with a 3% rate for affordable housing, and status updates on major engineering and civic building projects. The agenda also includes a memorandum on tree impacts from the James Cowan Theatre redevelopment. No administrative reports or delegations are scheduled.

investmentsmrdtaffordable-housingengineering-projectscivic-buildingsjames-cowan-theatretrees
Council Chamber, City Hall
Thu Feb 15, 2024 · 5:00 PM

Community Heritage Commission

Heritage commission to hear orientation, archives, and Telus boot preservation

The Community Heritage Commission is meeting to receive a governance orientation, hear a staff presentation on the City Archives and Burnaby Village Museum, and discuss correspondence about the preservation of the Telus Boot. No administrative reports are on the agenda, and no decisions are listed for this meeting.

heritagegovernancearchivesmuseumcorrespondence
Council Chamber, City Hall
Wed Feb 14, 2024 · 5:00 PM

Planning and Development Committee

Burnaby committee to weigh rental protection fund acquisition, housing progress

The Planning and Development Committee is meeting to consider a delegation from Entre Nous Femmes Housing Society regarding a Rental Protection Fund acquisition, and to seek approval of a Development Permit Transition process. Members will also receive updates on the HOME Strategy's 2023 progress and a rental housing summary as of December 31, 2023. Correspondence on short-term rentals from nine residents is on the agenda, and the committee will move into a closed session for land and negotiation matters.

housingrental-housingdevelopment-permithomelessnessshort-term-rentalsplanning
Council Chamber, City Hall
Tue Feb 13, 2024 · 5:00 PM

Parks, Recreation and Culture Committee

Committee to review alcohol-in-parks pilot, bike skills course, shuttle service

The Parks, Recreation and Culture Committee is meeting to hear staff reports and seek feedback on several recreation topics, including a review of the Responsible Consumption of Alcohol in Parks pilot program, a redevelopment plan for the Burnaby Mountain Bike Skills Course, and a proposed shuttle bus service for seniors during facility construction. The committee will also receive an invited presentation on committee orientation and governance updates, and hear a delegation about a seniors' weight room at Confederation Park. No administrative reports or minutes are on the agenda.

parksrecreationalcoholbike-skillsshuttle-busseniorsgovernance
Council Chamber, City Hall
Mon Feb 12, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Council reviews rezoning submissions for 3777-3791 Kingsway and correspondence

This is a Council correspondence and public notice submissions meeting where staff notes and referrals are presented. The most substantive item is the public notice submissions for rezoning application REZ#20-09 at 3777 and 3791 Kingsway, which include multiple letters from residents and organizations. Other items include requests to join the Sue Big Oil campaign, a BIA renewal for the Heights Merchants Association, and various correspondence referred to committees or provided for information.

rezoningcorrespondencepublic-noticebusiness-improvement-areaenvironmenttransportationhousing
Mon Feb 12, 2024 · 5:00 PM

City Council Meeting

Council to consider water metering, contracts, and zoning bylaws

The Burnaby City Council is meeting to consider several administrative reports, including a water metering strategy for new developments, contract awards for an electric refuse truck, pavement restoration, and storm network expansion, and a report on cost recovery for the Parkland Refinery incident. The council will also hold readings for several zoning and building bylaw amendments, including parking changes and the Zero Carbon Step Code, and consider a notice of motion on a community investment model for sustainable energy.

water-meteringcontractszoningbuilding-bylawfinancial-planutilitiestransportation
Council Chamber, City Hall
Thu Feb 8, 2024 · 5:00 PM

Board of Variance

Board of Variance to hear laneway home height and retaining wall appeal

The Burnaby Board of Variance is meeting to elect a chair, adopt prior minutes, and hear one appeal application. The sole appeal seeks variances from the Burnaby Zoning Bylaw to allow a taller laneway home and a higher retaining wall at 5359 Empire Drive.

board-of-variancezoningvariancelaneway-homeretaining-wallburnaby
Council Chamber, City Hall
Wed Jan 31, 2024 · 5:00 PM

Access Advisory Committee

Burnaby advisory committee to hear gondola equity, accessibility updates

The Access Advisory Committee meets to receive an orientation and governance update, hear a TransLink presentation on equity considerations for the Burnaby Mountain Gondola, and get verbal and written updates on the City's Accessibility Plan and accessible seniors' outings. No administrative reports are listed, and no decisions are on the agenda.

accessibilitytransitgondolagovernanceseniorsparks
Mon Jan 29, 2024 · 5:00 PM

City Council Meeting

Council to vote on 2024-2028 financial plan and $5.8M in housing grants

Burnaby City Council is meeting to consider the 2024-2028 Financial Plan and related bylaw, along with several contract awards and increases. Council will also decide on two grants totaling $5.8 million for non-market housing developments, and discuss updates on the new RCMP detachment and City Hall relocation.

budgethousingzoningpolicecontractsfinancial-plan
Council Chamber, City Hall
Mon Jan 29, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Burnaby Council reviews correspondence and public notices

This meeting consists of receiving and reviewing various pieces of correspondence and public notice submissions. Items include staff responses to resident inquiries, referrals to advisory committees, and public feedback on rezoning and short-term rentals.

correspondencezoningtransportationpublic-noticehousing
Thu Jan 25, 2024 · 1:00 PM

Special Council Meeting

Special council meeting with no listed agenda items

This is a special council meeting agenda for Burnaby, BC on January 25, 2024. The agenda text contains only procedural boilerplate and no listed agenda items, decisions, or discussion topics.

council-meetingprocedural
Council Chamber, City Hall
Thu Jan 25, 2024 · 5:00 PM

Transportation Committee

Traffic safety letter, cycling projects, bus shelters on agenda

The Burnaby Transportation Committee is meeting to discuss traffic safety improvements, including a proposed letter to the provincial government, and to receive updates on cycling network projects and the bus shelter expansion program. The agenda also includes delegations on neighbourhood safety and a four-way stop concern, plus an orientation presentation.

traffic-safetycyclingbus-shelterspedestrian-safetydelegations
Council Chamber, City Hall
Wed Jan 24, 2024 · 5:00 PM

Social Planning Committee

Burnaby Social Planning Committee to hear food strategy, governance updates

The Social Planning Committee is meeting to receive invited presentations on committee orientation and governance updates, and on the Burnaby Food Systems Strategy. The agenda also includes correspondence from residents about a municipal bylaw regarding rodeos, and a notice of motion from Councillor Santiago to establish Social Change Awards. No administrative or information reports are listed.

food-systemsgovernancesocial-planningawardsrodeos
Council Chamber, City Hall
Wed Jan 17, 2024 · 5:00 PM

Executive Committee of Council

Burnaby Executive Committee to decide arts council grant and festival funding

The Executive Committee of Council is meeting to consider two funding items: an operating grant for the Burnaby Arts Council and grant applications for Festivals Burnaby received in October 2023. The meeting will also include a delegation from the Burnaby Arts Council and adoption of previous minutes. No other substantive business is listed.

grantsartsfestivalsbudgetcouncil-meeting
Council Chamber, City Hall
Mon Jan 15, 2024 · 5:00 PM

City Council Meeting

Council to consider 24/7 winter shelter, rezoning, and BRT petition

Burnaby City Council is meeting to decide on several land-use items, including a request to extend winter shelter hours at 7320 Buller Avenue to 24/7, and to approve temporary use and development variance permits. Council will also give final adoption to four highway closure bylaws and consider a petition from the Heights Merchants Association supporting a Bus Rapid Transit route on Boundary Road.

zoninghousingsheltertransportationbylawspermits
Council Chamber, City Hall
Mon Jan 15, 2024 · 12:00 PM

Council Correspondence

Council reviews correspondence on housing, transit, climate, and recreation

This is a Council Correspondence Package for January 15, 2024, where Council reviews and directs responses to public correspondence. Items include staff notes on boulevard treatments and climate action, referrals to advisory committees, and information items on housing legislation, transit proposals, and tax exemptions. No decisions are made at this meeting; it is a procedural review of correspondence.

correspondencehousingtransitclimaterecreationtax-exemption
Thu Jan 11, 2024 · 5:00 PM

Board of Variance

Board of Variance hears three appeals for building height relaxations

The Burnaby Board of Variance will hear three appeals on January 11, 2024, each seeking relaxation of zoning bylaws to allow building heights exceeding the maximum. The board will also elect a chair, adopt minutes from the November 30, 2023 hearing, and handle other business.

board-of-variancezoningbuilding-heightvarianceburnaby
Council Chamber, City Hall
Thu Jan 11, 2024 · 9:30 AM

International Relations and Friendship Cities Committee

Committee to review sister-city interest from Cagayan de Oro, Mesa invite, Taiwan reference issue

The International Relations and Friendship Cities Committee is meeting to review correspondence, including an expression of interest for sister city relations from Cagayan de Oro, an invitation to Mesa, Arizona, and a complaint about a misreference of Taiwan in friendship city documents. No administrative or information reports are on the agenda, and no delegations are scheduled.

international-relationsfriendship-citiessister-citiescorrespondence
Council Committee Room, City Hall
Wed Jan 10, 2024 · 5:00 PM

Planning and Development Committee

Burnaby committee to weigh parking bylaw changes, Brentwood plan update

The Planning and Development Committee will consider proposed zoning bylaw amendments for parking and loading, an update to the Brentwood Site Conceptual Master Plan, and a Housing Choices program update. No delegations or correspondence are listed.

zoningparkingbrentwoodhousingplanning
Council Chamber, City Hall