The Boring PartsFederalLocal · USLocal · Canada
Burnaby, British Columbia

Burnaby public meetings in 2024

61 substantive meetings from 2024, with official agendas or minutes and plain-English summaries.

Mon Dec 16, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Council reviews public correspondence on zoning, bylaws, and city services

This meeting consists of a review of correspondence and public notice submissions. Council and staff are addressing requests regarding building codes, anti-idling bylaws, and traffic noise, while receiving information on zoning and international delegations.

zoningtrafficbylawsbuilding-codepublic-correspondence
Mon Dec 16, 2024 · 5:00 PM

City Council Meeting

Council to review Brentwood Community Centre budget and multiple rezoning requests

Burnaby City Council is meeting to decide on an updated budget for the Brentwood Community Centre and a draft Urban Forest Strategy. The body will also consider several rezoning applications for residential and mixed-use developments and approve contracts for recycling trucks and insurance.

zoningbudgethousingenvironmentinfrastructuregrants
Council Chamber, City Hall
Wed Dec 4, 2024 · 2:00 PM

Executive Committee of Council

Council to endorse interim naming guidelines for civic assets

The Executive Committee will consider endorsing a set of interim guidelines and procedures for naming civic assets, pending a comprehensive naming policy. It will also review and approve the second intake of the Festivals Burnaby Grant program. The committee will vote on two $500 donation requests – one for Hope and Health’s 4th Annual Santa on the Pitch event and another for the Tsleil‑Waututh Nation Christmas Hamper and Toy Drive. Standard agenda items such as adoption of the agenda, minutes, and routine reports will also be addressed.

naminggrantscommunitycouncilpolicy
Council Chamber, City Hall
Mon Dec 2, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Burnaby council to consider removal of 166 trees for Cameron Centre redevelopment

At this meeting, Burnaby City Council will review staff notes on several public submissions, including a request to cut 166 trees for the Cameron Centre redevelopment, a proposal to amend the Business Licence Bylaw, and concerns about uncontrolled intersections at Southpoint Drive and Mission Avenue. Council members may ask questions, but no formal decisions are scheduled.

treesbylaw-amendmenttraffichousingparkingpublic-noticeplanning
Mon Dec 2, 2024 · 5:00 PM

City Council Meeting

Council to adopt zoning amendment for six‑storey rental and childcare at 7388 Southwynde

The City Council will consider a final adoption of Burnaby Zoning Bylaw Amendment No. 15 (REZ #22-02) that permits a six‑storey non‑market rental building with a childcare facility at 7388 Southwynde Avenue. The meeting also includes approvals for several contract awards, including group benefits providers (Manulife and Pacific Blue Cross), an Owner’s Representative for infrastructure delivery, and a contract for signage, road pavement markings and related electrical services. Additional items on the agenda are the Universal Water Metering Strategy presentation and updates on transit‑oriented area designations and unsightly premises bylaws.

zoninghousingchildcarecontractsinfrastructurebylawwatertransit
Council Chamber, City Hall
Thu Nov 28, 2024 · 5:00 PM

Access Advisory Committee

Committee reviews Draft Accessibility Plan and pedestrian safety measures

The Access Advisory Committee will discuss the Draft Accessibility Plan for the City of Burnaby, presented by senior planners. It will also receive information on Accessible Pedestrian Signals, including a map of intersections with touchless signals. A delegation from Walkers' Caucus will present on intersection crossing safety for vulnerable pedestrians. No formal decisions are listed on the agenda.

accessibilitytransportationpedestrian-safetyplanningcommunity-engagement
Wed Nov 27, 2024 · 5:00 PM

Public Safety Committee

Delegation on children crossing safety at Twelfth Avenue Elementary

The Public Safety Committee will hear a presentation from the Twelfth Avenue Elementary Parent Advisory Council about children crossing 12 Ave and vehicles not stopping at stop signs. The committee will also receive status updates on the Burnaby Community Safety Plan, RCMP operations for August‑September 2024, and the Fire Department. Additional reports from the Community Safety Advisory Committee districts will be reviewed.

public-safetytrafficcommunitypolicefirereports
Council Chamber, City Hall
Thu Nov 21, 2024 · 5:00 PM

Transportation Committee

Transportation Committee to consider approval of Burnaby EV charging strategy

The Transportation Committee will adopt its agenda and the minutes from the October 10 meeting, hear delegations on parking and intersection safety, and receive staff presentations on three projects. The committee will seek approval of the Burnaby Public Electric Vehicle Charging Strategy recommendations and implementation framework. Additional presentations will cover the Canada Way Bus Speed and Reliability Study and the Phase 2 update of the Edmonds Town Centre Cycling Network Project.

transportationelectric-vehiclesbus-speedcyclingparking-safetyintersection-safety
Council Chamber, City Hall
Tue Nov 19, 2024 · 2:00 PM

Financial Management Committee

Board of Trade delegation discusses partnership with the city

The Financial Management Committee will adopt its agenda and the minutes from the October 15 meeting. It will hear a delegation from the Burnaby Board of Trade presenting a partnership proposal, with speakers Angie Whitfield and Dana Martin. The committee will also receive updates on major capital projects in parks, recreation and culture, key IT initiatives for July‑December 2024, major civic building projects, and major engineering projects.

board-of-tradecapital-projectsit-initiativescivic-buildingsengineeringfinance
Council Chamber, City Hall
Mon Nov 18, 2024 · 11:00 AM

International Relations and Friendship Cities Committee

Committee provides updates on sister and friendship city partnerships

The International Relations and Friendship Cities Committee will adopt its agenda and the minutes from its September 26 meeting, hear a verbal report on the status of sister and friendship city requests, and review correspondence from Shuangliu District, the City of Kushiro, and Hwaseong City.

international-relationssister-citiesfriendship-citiescorrespondencereports
Council Chamber, City Hall
Mon Nov 18, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Council reviews BC Hydro Community Regreening Program update

Burnaby City Council will consider several correspondence items submitted for information. The agenda includes updates from Ministry of Children and Family Development, BC Hydro, Metro Vancouver, and local staff on topics such as adoption awareness, community regreening, affordable housing guidance, bus lane plans, and the Cameron Recreation Centre. No decisions or votes are scheduled; the council will simply receive and acknowledge the information.

environmenthousingtransportationcommunitychildren-services
Mon Nov 18, 2024 · 5:00 PM

City Council Meeting

Council to consider TransLink bus speed plan and multiple bylaws

The Burnaby City Council will adopt the agenda and minutes, hear a TransLink presentation on improving bus speed and reliability on Hastings Street, and consider several administrative reports. Items include funding for temporary Cameron Library staff, a new Unsightly Premises Bylaw, a five‑year service agreement with RecycleBC, and authorizations for multiple rezoning applications. The council will also review grant applications, fee‑bylaw amendments, and acting mayor appointments.

transitbusbylawrezoninglibraryrecyclinggrantscouncil
Council Chamber, City Hall
Thu Nov 14, 2024 · 5:00 PM

Community Heritage Commission

Commission reviews heritage permits and agreements for local landmarks

The Community Heritage Commission is discussing a Heritage Revitalization Agreement for the Lonsdale Guardhouse Residence and a Heritage Alteration Permit for Overlynn Mansion. The body will also receive a status update on the Community Archives Strategy and Implementation Plan.

heritagezoningarchivesbylawspreservation
Council Chamber, City Hall
Wed Nov 13, 2024 · 5:00 PM

Planning and Development Committee

Proposed amendments to allow short‑term rentals and clarify EV charging rules

The Planning and Development Committee will hear a delegation from Trinity Presbyterian Church regarding a proposed redevelopment at 7457 Edmonds. It will review proposed amendments to the Burnaby Zoning Bylaw that would permit short‑term rentals in buildings with secondary suites and clarify electric‑vehicle parking requirements. Staff will present preliminary findings from the Phase 3B Land‑Use Framework engagement. The meeting also includes routine agenda and minutes adoption.

zoninghousingtransportationdevelopmentplanning
Council Chamber, City Hall
Tue Nov 12, 2024 · 5:00 PM

Parks, Recreation and Culture Committee

BC Parkway Project update presented to committee

The Parks, Recreation and Culture Committee will receive a verbal report updating members on the BC Parkway Project. A second verbal report will provide information on the Fees and Charges Policy Framework. No decisions or votes are listed on the agenda.

parksrecreationcultureinfrastructurefees
Council Chamber, City Hall
Wed Nov 6, 2024 · 5:00 PM

Environment Committee

Committee reviews small gas equipment delegation and climate action progress

The Burnaby Environment Committee will hear a presentation from Metro Vancouver staff about small gas‑powered equipment. It will also receive a Climate Action Framework Progress Report covering 2023‑2024. The meeting includes routine items such as adoption of the agenda and minutes, and concludes with adjournment.

environmentair-qualityclimate-actionreportsequipment
Council Chamber, City Hall
Wed Nov 6, 2024 · 2:00 PM

Executive Committee of Council

Council will approve updates to the Community Grant Policy and award several local grants

The Executive Committee will consider and vote on proposed updates to the Community Grant Policy. It will also review and authorize a grant for the Down Syndrome Resource Foundation and award lunch/dinner grants to Burnaby seniors' groups. A verbal report on procedure bylaw updates will be presented.

grantscommunityseniorsbylawcouncil
Council Chamber, City Hall
Mon Nov 4, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Council reviews public correspondence and rezoning submissions

This meeting consists of a review of correspondence and public notice submissions. The items include requests for information, referrals to advisory bodies, and public feedback on a specific rezoning application.

zoningheritageparkingstadiumdevelopment
Mon Nov 4, 2024 · 5:00 PM

City Council Meeting

City Council to approve 2025 water and sewer utility rates

Burnaby City Council will consider approval for 2025 Waterworks and Sanitary Sewer utility rates, along with related bylaw amendments. The meeting also includes reports on the Burnaby Housing Needs Report, the Burnaby Food System Strategy, and the Burnaby Child Care Design Principles and Guidelines.

watersewerrateshousingfoodchild-carebylawcouncil
Council Chamber, City Hall
Thu Oct 24, 2024 · 5:00 PM

Access Advisory Committee

Committee reviews Brentwood Town Centre accessibility pilot

The Access Advisory Committee will receive an information report regarding the Brentwood Town Centre Accessibility Improvement Pilot. The meeting also includes a presentation on the Mobility Access Participation (MAP) Project.

accessibilitytransportationbrentwood-town-centreurban-planning
Wed Oct 23, 2024 · 5:00 PM

Public Safety Committee

Burnaby to develop B‑SAFER earthquake resilience framework

The Public Safety Committee will adopt its agenda and the minutes from the June 26, 2024 meeting. It will review the new Earthquake Strategies and Actions Framework and hear a verbal report on bear‑spray use in the city. The committee will also receive status updates from the Community Safety Advisory Committee districts, the RCMP (April‑July 2024) and the Fire Department, plus a summary of 2024 extreme‑heat events.

earthquakepublic-safetyrcmpfirebear-sprayheat
Council Chamber, City Hall
Tue Oct 22, 2024 · 5:00 PM

Environment Committee

Committee reviews sturgeon partnership and cat‑control bylaw proposals

The Environment Committee will hear two invited presentations: the Fraser River Sturgeon Conservation Society will discuss a possible partnership, and the Stewardship Centre for BC will present a proposal for cat‑control bylaws. The committee will also consider correspondence on the Fossil Fuel Treaty, a biodiversity bylaw reform, and the Starry Night Initiative. No formal decisions are listed on the agenda.

environmentwildlifebylawsbiodiversitycat-controlsturgeonfossil-fuel
Council Chamber, City Hall
Mon Oct 21, 2024 · 5:00 PM

City Council Meeting

Council to consider rezonings, transit shelters, and liquor policy changes

The Burnaby City Council will consider rezoning proposals for industrial and multi-family developments, approve a contract increase for transit shelters, and adopt bylaws related to liquor licensing and inter-municipal business fees.

zoningtransitliquorbusiness-licencedevelopmentcouncilbylaw
Council Chamber, City Hall
Mon Oct 21, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Council reviews correspondence on fossil fuels, recreation, and cycling

This meeting consists of a review of correspondence and public notice submissions. Items are being referred to advisory bodies or provided to Council for information.

correspondenceenvironmentrecreationcyclinghousing
Thu Oct 17, 2024 · 5:00 PM

Planning and Development Committee

Committee reviews draft community plans for Edmonds, Royal Oak, and Cascade Heights

The Planning and Development Committee is discussing updates to the Burnaby Housing Needs Report to meet provincial requirements. The body is also seeking endorsement for draft community plans for three areas to begin a final phase of public engagement.

housingcommunity-planningzoningburnaby
Council Chamber, City Hall
Wed Oct 16, 2024 · 5:00 PM

Social Planning Committee

Committee reviews draft food system strategy and child care design guidelines

The Social Planning Committee is reviewing draft strategies for food systems and child care design principles to be presented for Council approval. The meeting also includes presentations on poverty reduction and food security.

food-securitychild-carepoverty-reductionsocial-planning
Council Chamber, City Hall
Tue Oct 15, 2024 · 2:00 PM

Financial Management Committee

Committee considers temporary financing bylaw for 2025 expenditures

The Financial Management Committee is meeting to discuss borrowing authority for 2025 spending and a joint funding application for renewable energy. The body will also review financial reports and status updates on housing and civic building projects.

budgetfinancingrenewable-energyhousinginfrastructure
Council Chamber, City Hall
Thu Oct 10, 2024 · 5:00 PM

Transportation Committee

Committee considers pedestrian safety measures and new sidewalk program

The Transportation Committee is reviewing a feasibility assessment for pedestrian safety improvements to approve short-term measures and detailed designs. The body will also receive presentations on a new sidewalks program and an Intelligent Transportation Systems Strategic Plan.

pedestrian-safetysidewalkstraffic-safetytransportation-planning
Council Chamber, City Hall
Mon Oct 7, 2024 · 5:00 PM

City Council Meeting

Council to consider a new height‑based development framework and related policy changes

The Burnaby City Council will adopt the agenda and minutes, then review several administrative reports including a proposed height‑based development framework and approvals for contracts such as the Burnaby Laneway Upgrades and re‑roofing of the Bonsor Recreational Complex. Committee reports will present proposed zoning bylaw amendments for child‑care and the new R1 district, a review of the Tenant Assistance Policy, and a study of short‑term rental options. The council will also conduct third‑reading votes on rezoning applications at 4472 and 4828 Hastings Street and adopt fee‑bylaw amendments for 2025. A scheduled public hearing for October 29 is slated for cancellation due to lack of items.

zoningdevelopmentcontractsbylawshousinginfrastructure
Council Chamber, City Hall
Mon Oct 7, 2024 · 10:00 AM

Tax Sale

Tax Sale meeting scheduled for October 7, 2024

The provided agenda contains only procedural boilerplate and software interface text. No specific items, decisions, or discussion topics are listed in the record.

tax-saleprocedural
Council Chamber, City Hall
Mon Oct 7, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Council reviews staff notes on laneway houses, noise bylaws, and sidewalk requests

The council will receive staff responses to several public submissions, including electrical interpretations for laneway houses, a request to reduce noise pollution and enforce the noise bylaw, and a request for sidewalks on Alaska Ave, Rosser Ave, and Juneau St. These items are for information only and no council action is required. Additional submissions are listed for informational purposes, such as the Burnaby Draft OCP and a free transit pass proposal for youth.

zoningbylawhousinginfrastructurecommunity-planpublic-engagement
Council Chamber, City Hall
Wed Oct 2, 2024 · 5:00 PM

Executive Committee of Council

Council considers lease agreements for community facilities and grant applications

The Executive Committee of Council is meeting to review proposed lease agreements for two city facilities. The body will also consider recommended recipients for Fall 2024 community grants and a new framework for advisory body roles.

leasescommunity-grantsgovernancenon-profits
Council Chamber, City Hall
Thu Sep 26, 2024 · 2:00 PM

International Relations and Friendship Cities Committee

Committee to discuss draft Sister and Friendship Cities Policy

The International Relations and Friendship Cities Committee is meeting to establish a new Sister and Friendship Cities Policy. The body will also review correspondence regarding international partnerships.

international-relationspolicyfriendship-cities
Council Boardroom, City Hall
Wed Sep 25, 2024 · 5:00 PM

Planning and Development Committee

Committee will consider zoning bylaw changes for child care and R1 district

The Planning and Development Committee will review updates to the Tenant Assistance Policy, consider proposed amendments to the Zoning Bylaw to enable new child‑care spaces and support the new R1 district, and examine a council report on allowing short‑term rentals in primary dwellings with long‑term secondary suites. Information reports will provide updates on market and non‑market rental housing development and on the Burnaby 2050 Official Community Plan Phase 3A public‑engagement findings.

zoningchild-careshort-term-rentalhousingofficial-community-plan
Council Chamber, City Hall
Mon Sep 23, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

City to consider new sidewalks on 13th Avenue in future capital review

Council will review staff notes on several public submissions, including a request for new sidewalks on 13th Avenue, the removal of temporary tables and chairs at Metrotown Station, and outdoor art at Metrotown Station. Staff will provide information or follow‑up on low‑cost housing inquiries and the Burnaby Draft Official Community Plan. Items are being logged for future capital project review and advisory referral.

sidewalkstransportationparkshousingplanningcommunitypublic-noticeadvisory
Mon Sep 23, 2024 · 5:00 PM

City Council Meeting

Council to approve contract increase for Community Safety Building project

The Burnaby City Council will consider a range of items including administrative reports on child‑care funding, a mixed‑use rezoning at Canada Way, a temporary use permit for a food‑processing site, and several contract increases for city projects. Committee reports will present proposals for 2025 lease rates, a festivals grant, a civic plaque policy, naming guidelines for civic assets, and property tax exemptions. The meeting also includes consent agenda items on building permits and major engineering projects, and several bylaw readings related to zoning and highway closures.

zoningcontractscommunity-safetylibrarybridgetemporary-usehousing
Council Chamber, City Hall
Thu Sep 12, 2024 · 10:00 AM

Financial Management Committee

Committee to review property tax exemptions and housing initiative funding

The Financial Management Committee is seeking approval for permissive property tax exemptions for 2025 and 2026. The body will also discuss the use of provincial capacity funding for local government housing initiatives and receive updates on major engineering and civic building projects.

property-taxhousinginfrastructurebudgetcivic-buildings
Council Chamber, City Hall
Tue Sep 10, 2024 · 5:00 PM

Parks, Recreation and Culture Committee

Committee receives updates on Central Park and Burnaby Mountain plans

The Parks, Recreation and Culture Committee is meeting to receive verbal staff reports on several park initiatives. These include updates on environmental programs, trail management, and master planning.

parksenvironmenttrailsplanning
Council Chamber, City Hall
Mon Sep 9, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Council reviews public notice submissions, including rezoning of Sunset and Kincaid Streets

Burnaby City Council will review correspondence and public‑notice submissions received for the September 9, 2024 meeting. Items include a rezoning request (REZONING #20-15) for Sunset Street and Kincaid Street, several informational documents from neighboring municipalities, and updates on regional projects. No decisions are recorded; the council will consider the information presented.

zoningregional-planninginfrastructurepublic-noticecouncil
Bill Copeland Sports Centre
Mon Sep 9, 2024 · 5:00 PM

City Council Meeting

Council adopts fee, zoning, expropriation bylaws and housing agreements

The council will adopt several amendment bylaws affecting fees, fire services, sewer connections, parking meters, electric‑vehicle charging, and a Boundary Road maintenance agreement. It will consider zoning bylaw amendments for REZ #23‑01 (8304 11th Avenue), REZ #23‑22 (4567 Canada Way) and REZ #24‑06 (4657 Kingsway), as well as a housing agreement bylaw for 3856 and 3864 Carrigan Court. Administrative reports will seek approval for a housing agreement on a portion of 7000 Lougheed Highway, the expropriation of part of 5595 Roy Street for the Holdom Overpass project, and a contract increase for hired equipment services. Additional items include a short‑term rental amendment to the zoning bylaw and a mayoral reconsideration of Bylaw 14207, while two public hearings are cancelled.

zoningfeeshousingexpropriationcontractsbylawsdevelopment
Council Chamber, City Hall
Wed Sep 4, 2024 · 2:00 PM

Executive Committee of Council

Committee to review lease rates and grants for Community Resource Centres

The Executive Committee of Council is meeting to discuss administrative policies and funding. The body is seeking approval for naming guidelines, plaque policies, and grant recommendations.

grantsnon-profitscivic-policycommunity-resources
Council Chamber, City Hall
Mon Aug 26, 2024 · 11:00 AM

Council Correspondence and Public Notice Submissions

Council reviews staff notes, advisory referrals, and rezoning submissions

On August 26, 2024, Burnaby City Council will consider a package of correspondence and public‑notice submissions. Items include staff notes on waste‑stream recycling, a new sidewalks program for Madison and Rosser Avenues, and a proposal to promote quieter, greener equipment under the noise bylaws. The council will also refer biodiversity bylaw reform letters to the Environment Committee and review a rezoning submission for properties on Sunset Street and Kincaid Street.

councilcorrespondencepublic-noticerezoningsidewalkswaste-recyclingnoise-bylawsbiodiversity
Mon Aug 26, 2024 · 5:00 PM

City Council Meeting

Burnaby Council to consider new Indigenous relations framework and fee changes

City Council is reviewing a proposed Indigenous Relations and Reconciliation framework and strategy. The meeting includes decisions on several contract awards for infrastructure and road upgrades, as well as proposed fee changes for January 1, 2025.

indigenous-relationszoninginfrastructurefeeshousing
Council Chamber, City Hall
Tue Jul 23, 2024 · 2:30 PM

International Relations and Friendship Cities Committee

Committee to consider approving 2025 sister‑city delegation to Japan, Korea, Taiwan

The International Relations and Friendship Cities Committee will adopt its agenda and the minutes from the January 11, 2024 meeting. It will receive a report on learning outcomes from the recent sister‑city visit to Mesa, Arizona. The committee will consider approving a council delegation for a 2025 visit to sister cities Kushiro (Japan) and Hwaseong (South Korea) and friendship city Taichung (Taiwan).

international-relationssister-citiestravelreportscorrespondence
Council Chamber, City Hall
Mon Jul 22, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Council reviews staff responses to public correspondence and notices

This meeting consists of correspondence and public notice submissions. Staff provided responses regarding local ecology, parking bylaws, and infrastructure maintenance, while other items were referred to advisory bodies or provided for information.

zoningparkinginfrastructureenvironmentpublic-notices
Mon Jul 22, 2024 · 5:00 PM

City Council Meeting

Council to approve contract for Cameron Community Centre Phase II construction

The Burnaby City Council will consider a contract award to complete construction of the Cameron Community Centre and Library Phase II. It will also review a bylaw to introduce Development Cost Charge and Amenity Cost Charge waivers and reductions, and forward several rezoning proposals to future readings. Additional items include a community school grant payment and updates on various committees and policies.

zoninghousingdevelopmentcontractscommunity-grantsinfrastructurefinance
Council Chamber, City Hall
Mon Jul 22, 2024 · 1:00 PM

Special Council Meeting

City to review Urban Forest Strategy Phase 2 visioning

City Council will receive an information report on the Urban Forest Strategy Phase 2 visioning process and results. Staff will present findings from public engagement and a visioning presentation.

urban-forestenvironmentplanningcouncil
Council Chamber, City Hall
Tue Jul 16, 2024 · 2:00 PM

Financial Management Committee

Council to approve the 2024‑2034 Community Works Fund Agreement

The Financial Management Committee will consider and seek approval for the new 2024‑2034 Community Works Fund Agreement. It will also review a proposed increase to on‑street public pay parking fees in the Metrotown Town Centre. Additional items include a financial report for period 05, updates on major civic building and engineering projects, and a report on key IT initiatives. The meeting is closed to the public under the Community Charter.

community-worksparking-feesfinancecivic-buildingsengineeringit-initiatives
Council Chamber, City Hall
Wed Jul 10, 2024 · 5:00 PM

Planning and Development Committee

Burnaby reviews land use engagement plan and liquor policy directives

The committee will consider a proposed engagement plan for the Burnaby 2050 Draft Land Use Framework. Staff will also seek approval for recommended liquor and cannabis policy directives. Additionally, the meeting includes discussions on transportation demand management in transit-oriented areas.

zoninghousingliquorcannabistransportationplanning
Council Chamber, City Hall
Mon Jul 8, 2024 · 5:00 PM

City Council Meeting

Burnaby Council reviews major residential, hotel, and infrastructure proposals

The meeting includes discussions on development procedures, anti-racism frameworks, and infrastructure projects. Council will also review contract awards for road rehabilitation, food supplies, and sidewalk expansions. Additionally, several rezoning applications for residential and hotel developments are up for final readings.

zoninghousinginfrastructuredevelopmentbylawsfifa
Council Chamber, City Hall
Thu Jul 4, 2024 · 5:00 PM

Board of Variance

Zoning appeal for new single-family home at 4391 Mahon Avenue

The Board of Variance will review an application for property variances at 4391 Mahon Avenue. The appeal seeks to permit a new single-family dwelling with a secondary suite, a detached garage, and an uncovered swimming pool. Requested changes include adjustments to front yard depth, building setbacks, and fence height.

zoninghousingresidentialappealburnaby
Council Chamber, City Hall
Wed Jun 26, 2024 · 5:00 PM

Public Safety Committee

Public Safety Committee to discuss parking issues and crime reports

The committee will hear a delegation regarding parking issues on Canada Way and Sperling Avenue. The agenda also includes updates on catalytic converter theft, RCMP operations, and fire department activities.

parkingcrimercmpfire departmentpublic safety
Council Chamber, City Hall
Tue Jun 25, 2024 · 9:00 AM

Planning and Development Committee

Committee reviews bylaw amendments and stormwater rules for multi-unit housing

The committee will review proposed amendments to the Burnaby Development Procedures Bylaw. Staff will also present on stormwater management requirements for R1 Small Scale Multi-Unit Housing zones. Additionally, the committee will receive findings from an employment lands needs assessment.

zoninghousingbylawsstormwatereconomic-development
Council Chamber, City Hall
Mon Jun 24, 2024 · 5:00 PM

City Council Meeting

Burnaby Council considers major residential rezoning and new EV charging rules

The meeting includes a final report from the Mayor's Task Force on Unsheltered Community Members. Council will also consider several rezoning applications for residential and self-storage facilities. Additionally, the agenda features updates on transit-oriented areas and new electric vehicle charging mandates.

zoninghousingtransitinfrastructureenvironment
Council Chamber, City Hall
Mon Jun 24, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Staff notes intention to pave and maintain Avalon Trail

This meeting reviews council correspondence and public notices. Engineering staff noted plans to address uneven surfaces on the Avalon Trail through paving work to improve safety and width. The agenda also includes various Metro Vancouver reports and community correspondence.

trailsinfrastructureenvironmentpublic noticecorrespondence
Wed Jun 19, 2024 · 5:00 PM

Environment Committee

Committee to consider 2024 World Rivers Day program approval

The committee will review a proposed program for 2024 World Rivers Day for approval. Members will also receive updates on the City Energy Strategy and the Construction and Demolition Waste Diversion Bylaw implementation. Two delegations are scheduled to present to the committee.

environmentenergywastebylawsclimate
Council Chamber, City Hall
Thu Jun 13, 2024 · 5:00 PM

Community Heritage Commission

Proposal to integrate 6570 Deer Lake Avenue into Deer Lake Park

The Commission will review a proposal to incorporate the Louis and Annie Hill Residence at 6570 Deer Lake Avenue into Deer Lake Park for visitor use. Staff will also provide updates on the Heritage Burnaby website and the Community Archives Strategy.

heritagearchivesparksburnaby
Council Chamber, City Hall
Tue Jun 11, 2024 · 5:00 PM

Parks, Recreation and Culture Committee

Committee reviews park protection, prioritization, and FIFA event opportunities

The committee will review several information reports regarding city parks and community services. Discussions include park prioritization, land protection strategies, and the BC Parkway Framework Plan. Members will also provide feedback on outdoor aquatics and potential FIFA partnerships.

parksrecreationplanningfifacommunity-events
Council Chamber, City Hall
Mon Jun 10, 2024 · 12:00 PM

Council Correspondence and Public Notice Submissions

Burnaby Council reviews correspondence on transit, housing, and energy

This meeting consists of reviewing correspondence provided to Council for information. The items include communications regarding the Sue Big Oil campaign, District Energy Utilities, and a proposed BRT line.

housingtransitenergypublic-noticeburnaby
Mon Jun 10, 2024 · 5:00 PM

City Council Meeting

Burnaby Council moves to adopt new small-scale multi-unit housing regulations

The City Council is reviewing several bylaw amendments, including transit-oriented area designations and building energy standards. The meeting also includes the final adoption of rezoning for small-scale multi-unit housing in residential neighborhoods.

housingzoningtransitenvironmentbylawsinfrastructure
Council Chamber, City Hall
Wed Jun 5, 2024 · 5:00 PM

Executive Committee of Council

Council to consider summer grant recommendations for Festivals Burnaby

The Executive Committee will review grant recommendations for the Summer Intake 2024 Festivals Burnaby Grant Program. The meeting also includes a presentation from the Burnaby Arts Council and correspondence regarding the Whey-ah-Wichen Canoe Festival.

grantsartsfestivalscommunity-events
Council Chamber, City Hall